- Recombinant Mouse Transmembrane protein 141 (Tmem141)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1249325
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 11,893 Da
- E Coli or Yeast
- 1-108
- transmembrane protein 141
- AI663999, 1110065P14Rik, D2Ertd217e
- Transmembrane protein 141 (Tmem141)
Sequence
MVNLGLSRVDDAVAARHPGLEEFAACQSHAFMKGVFTFVTGTGATFGLLMFIKRKFPYPVQWSFLVSAIAGSVASYRVTSMECQKCSNLWLFLETGQLPKDISTDPHD